PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family EIL
Protein Properties Length: 286aa    MW: 32461.4 Da    PI: 8.9391
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-16842PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3446.81.8e-136422861251
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                +el++rmwkd+mllkrlke++k+    ke  ++a k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+kv+
  Vun008103  42 DELEHRMWKDKMLLKRLKEQSKS----KEG-IDAVKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVR 136
                79*******************98....788.********************************************************************* PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaai+kyqa+++i+++++++++    ++h+l+elq+TtlgSLLsalmqhcdppqrrfplekg++pPWWPtG+e ww++ gl+kdq++ppykkphd
  Vun008103 137 FDRNGPAAITKYQADHAIPGRNDGCNS-IGPTPHTLQELQETTLGSLLSALMQHCDPPQRRFPLEKGIPPPWWPTGNEVWWPQIGLPKDQSPPPYKKPHD 235
                *************************88.9*********************************************************************** PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHT CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvln 251
                lkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++n
  Vun008103 236 LKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIIN 286
                ***********************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048738.2E-12842286No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-70162286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167685.1E-59168286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGFCNDLDTV PATLGEENIT TGQTDPEAIV EDDFSDEEIG VDELEHRMWK DKMLLKRLKE  60
QSKSKEGIDA VKQRQSQEQA RRKKMSRAQD GILKYMLKMM EVCKAQGFVY GIIPEKGKPV  120
TGASDNLREW WKDKVRFDRN GPAAITKYQA DHAIPGRNDG CNSIGPTPHT LQELQETTLG  180
SLLSALMQHC DPPQRRFPLE KGIPPPWWPT GNEVWWPQIG LPKDQSPPPY KKPHDLKKAW  240
KVGVLTAVIK HMSPDIAKIR KLVRQSKCLQ DKMTAKESAT WLAIIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B2e-771672862121Protein ETHYLENE INSENSITIVE 3
4zds_A2e-771672862121Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518529.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246061e-174EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLQ8SA700.0Q8SA70_VIGRA; Transcription factor EIL2
STRINGGLYMA13G03660.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-175EIL family protein